PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI11G15370.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 176aa    MW: 19871.7 Da    PI: 6.8055
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI11G15370.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS23.85.1e-08337165200
             GRAS 165 LakfAeelgvpfefnvlvakrledleleeLrvkpgE 200
                      L k Ae+l+vpf+fn+ v++rl++l++e+Lrvk+gE
  ORUFI11G15370.1   3 LMKEAERLDVPFQFNP-VVSRLDALDVESLRVKTGE 37 
                      8899************.7****************99 PP

2GRAS95.11.1e-2954171234360
             GRAS 234 lsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpv 327
                       sPkv+vv+ qea+hn++ + erf+eal+yy+alfd le++++r s e + vEr llg+ei+n+         e he+le+W  rle aGF+ +
  ORUFI11G15370.1  54 ASPKVMVVTKQEASHNAALLTERFVEALNYYAALFDGLEVGAARGSVEHTRVERWLLGEEIMNI---------EWHERLERWVGRLEGAGFGRI 138
                      58************************************************************98.........458999*************** PP

             GRAS 328 plsekaakqaklllrkvksdgyrveeesgslvl 360
                      pls++a  qa+++ +  + dg++v ee+g l+l
  ORUFI11G15370.1 139 PLSYYALLQARRVAQGLGCDGFKVREEKGNLFL 171
                      ******************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098515.5191165IPR005202Transcription factor GRAS
PfamPF035141.8E-5337IPR005202Transcription factor GRAS
PfamPF035143.8E-2754171IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MALMKEAERL DVPFQFNPVV SRLDALDVES LRVKTGERRS QESGLSPSKS RADASPKVMV  60
VTKQEASHNA ALLTERFVEA LNYYAALFDG LEVGAARGSV EHTRVERWLL GEEIMNIEWH  120
ERLERWVGRL EGAGFGRIPL SYYALLQARR VAQGLGCDGF KVREEKGNLF LFFLIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-1455148233336GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1241511e-133AC124151.4 Oryza sativa Japonica Group cultivar Nipponbare chromosome 11 clone OSJNBb0019E05, complete sequence.
GenBankAP0149671e-133AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616256.11e-108PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 3
SwissprotQ9LPR81e-37SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A0E0R8R41e-126A0A0E0R8R4_ORYRU; Uncharacterized protein
STRINGSi001436m4e-88(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60438176
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.17e-39scarecrow-like 3